Friday, 4 February 2022

The double-letter pairs (gemination)

There are 10 doubles remaining for which there are 0 roots beginning with these letter pairs: hh kk cc ll nn yy pp xx qq rr ww. But, except for qq and rr, these doubled letters occur as second and third letters of roots.

The phenomenon of doubling letters but not at the beginning of a word goes by the name of gemination.

hh also occurs as a prefix - both the definite article and the hiphil and in some roots but not as a first letter - 888 times in a word or a root. Here are some samples.

RootWordGloss and Reference
hrmvnhhrmonhההרמונה towards the Harmon Amos 4:3
hvahhuaההוא that Amos 8:9
nhhnhi נהי to moan Amos 5:16
ahhhoהו aye yai yai Amos 5:16
hrhhr ההר this hill Psalms 68:17
mhhhtmhmhti התמהמהתי I would linger Psalms 119:60
+vbhhi'tb ההיטב is it good Jonah 4:4
hiclvhhicl וההיכל and the palace Nahum 2:7

kk occurs in some roots and words. (51)

xkkxk צח is dazzling Song 5:10
wkk-twtokkiתשתוחחי be depressed Psalms 42:6
zkkumzikומזיח and the dam of Job 12:21
prkprkk פרחח the brood Job 30:12
kvkkk חח bracelet Exodus 35:22
akk-hak האח the hearth Jeremiah 36:22

cc is also known. And occurs doubled when it is a prefix. (410)

aicaicch איככה why Song 5:3
crmlccrml ככרמל like Carmel Song 7:6
mlcmlccm מלככם your Moloch Amos 5:26
sccsicutסכות the booth of Amos 5:26
clccolככל according to everything Joshua 21:44
sccbsç בסך undercover Psalms 42:5
cvcbccocbiככוכבי as the stars of Genesis 22:17

ll is frequent in roots and words including with the first being a prefix. (1,836)

lvillviim ללוים to the Levites Nehemiah 13:22
yvllyoll עולל progeny Jeremiah 44:7
hlcllct ללכת to go Jeremiah 44:3
gllgilulih גלוליה her figurines Jeremiah 50:2
wll-wollih שלליה spoiling her Jeremiah 50:10
sllsoluh סלוה extol her Jeremiah 50:26
gllvgilgltiç וגלגלתיך and roll you Jeremiah 51:25
kllkllim חללים the profaned Jeremiah 51:4
illhililu הילילו howl Jeremiah 51:8
hllthilh תהלה praise Psalms 65:2
plltpilh תפלה prayer Psalms 65:3

nn is frequent (1,167)

ainainnu איננו none of us Jeremiah 44:16
knntkinti תחנתי my supplication Jeremiah 38:26
hnhhnni הנני note me well Jeremiah 44:11
ynnhynn הענן of the cloud Deuteronomy 5:22
ynhtynnuתעננו you will answer us Psalms 65:6
rnntrnin תרנין to shout for joy Psalms 65:9

yy is frequent (801) as a root in ryy, but in a word it is rare (7).

rvyhtroyyiהתרועעי be jubilant Psalms 60:10
rvyatroyyאתרועע I will be jubilant Psalms 108:10
ryylhtroyyלהתרעע may lead to evil Proverbs 18:24
ryy-mryy מרעע injures Daniel 2:40
ryyhtroyyhהתרעעה is evil Isaiah 24:19
rvyiroyyירעע shout of triumph Isaiah 16:10
rvyitroyyuיתרועעו they shout in triumph Psalms 65:14

pp (55)

sppbsf בסף in the doorway of 1 Kings 14:17
cppaicf אכף and disturb myself Micah 6:6
kppkopfחפף considered faultless Deuteronomy 33:12
appappuniאפפני I was enveloped 2 Samuel 22:5
+ppv'tpofוטפף mincing Isaiah 3:16
xppaxpxf אצפצף I did twitter Isaiah 38:14

xx(183)

rxxhrxuxהרצוץ splintered 2 Kings 18:21
baxxboxxבוצץ Botsets 1 Samuel 14:4
qxxbqxh בקצה toward the end of Isaiah 7:18
nxxlnixoxלניצוץ a spark Isaiah 1:31
rxxrxuxרצוץ damaged Isaiah 42:3
kxxrbkxoxrotבחצצרות with the trumpets Ezra 3:10

rr(1,539)
brrbrh ברה pure Song 6:9
mrrmorמר myrrh Song 3:6
xrrxr צר there will be trouble Amos 3:11
wrworrçשררך your navel Song 7:3
grrgroniגרוני my gullet Psalms 69:4

Thursday, 3 February 2022

More rare initial pairs of letters for roots - with fewer than five roots each

 There are a lot of single usage roots (233 outside of the domain of Names) and single usage words (19,772) in the Hebrew Bible, far more than I have time to look at. Rather, I want to limit the low-usage words to those where the first two letters of the root are also rare.

There are only 29 such pages in the concordance.

ay(3)
aq(1)
h(1)
hk(3)
hc(1)
hx(1)
hq(1)
hw(1)
vh(1)
vi(1)
vn(1)
vp(1)
zg(1)
zz(1)
'ta(3)
't't(3)
ld(4)
lt(1)
m(4)
nl(1)
s't(2)
ss(2)
ya(2)
qt(4)
wx(1)
tg(3)
td(4)
tz(1)
tt(4)

This is not too many and it further explores the letter combinations that are avoided in the first two letters of a root. Some of these we have already met in the past few posts on Hebrew roots. (All the references are at the links)

ay(3) is the unique timber from my first post in the series.
aq(1) is the ibex.
h(1) is the emphatic separation of the definite article from its word.
hk(3) is a rarely used name.
hc(1) insult, used once in Job. It is a hapax in my translation also (of course).
hx(1) is a rarely used name. So is hq(1), and hw(1)
vh(1) likewise as well as vi(1), vn(1), and vp(1)
zg(1) is husk - another hapax.
zz(1) is a rarely used name.
'ta(3) is the Aramaic for good.
't't(3) frontlets. 
ld(4) is a rarely used name.
lt(1) a measure, a bit more of.
m(4) only four times is this prefix connected only to a pronoun.
nl(1) a benefaction.
s't(2) is a rarely used name. So is ss(2)
ya(2) the unique wood from the first post.
qt(4) zither.
wx(1) another measure - a smidgen.
tg(3) is a rarely used name. As are those at td(4)
tz(1) lopped.
tt(4) is a rarely used name.

Now the challenge is to assimilate all this detail about the letters and see if there is an explanation or two as to why in Hebrew certain sequential sounds are avoided.

17 more individual letter pairs that don't begin any roots

 I have been examining paired letter patterns in Hebrew roots. The previous two posts have dealt with vav and tet, the two letters that account for 20 of the 37 individual letter pairs that are not used in the first two letters of any roots. We also saw the 20 pairs (e.g. bp pb) of individual letter pairs that are rarely if ever used (except where a letter of the pair is used grammatically as a prefix or suffix letter).

The 17 remaining single letter pairs are: gs, ds, dx, hz, zw, / ka, kh, lz, ln, ls, / lx, sw, pm, xw, qz, / qk, ts

The reverse of each of these two letters is used as the first letter of some roots (they too may be rare but they are non-zero).

So are any of the above 17 sequences used at all in Hebrew phonation? 

gs - 0, ds - 10 - looks like two borrowed words and a name showing Song and Qohelet as having words of late origin.

prds prds פרדס are a paradise of Song 4:13
prds uprdsim ופרדסים and orchards Qohelet 2:5
hdsh -hdsh הדסה Hadassah Esther 2:7
hds hhdsim ההדסים the myrtle Zechariah 1:8
hds hds הדס a myrtle Isaiah 55:13
hds vhds והדס and myrtle Isaiah 41:19
prds hprds הפרדס the paradise Nehemiah 2:8
hds hds הדס myrtle Nehemiah 8:15

hz 0 in roots but many where h is acting as part of a prefix.
zw - 0, ka (107) mostly the infamous Ahab, and a few for the gloss clap perhaps showing that Psalms 98 is contemporary with Second Isaiah. The one instance with wind is the Aramaic grammatical use of aleph as the definite article.

mkaimkauימחאו clap Psalms 98:8
akabakab אחאב Ahab 2 Kings 1:1
ivkaviokaויחא and Joha 1 Chronicles 11:45
rvkrukaרוחא the wind Daniel 2:35
xika-xika ציחא Tsixa Ezra 2:43
plkaplka פלחא Pilexa Nehemiah 10:25

kh (1,317) - frequent as the last letter of a word and occasionally of a root. What do we make of this 'final h'? It is sometimes the suffix indicating direction - towards.

prkhprkh הפרחה the flourishing of Song 6:11
mwpkh-hmwpkh המשפחה the families Amos 3:1
mnkhumnkoticmומנחתיכם and your gifts Amos 5:22
+pk'tipkh טפחה cloaked Isaiah 48:13
xlkvhxlikh והצליחה and prosper Nehemiah 1:11
mnkhumnkthonומנחתהון and their gifts Ezra 7:17
wlkvawlkh ואשלחה and I sent Nehemiah 6:8
nkhhnkitm הנחיתם you guided them Nehemiah 9:12
mnkh-hmnkh המנחה the gift Nehemiah 13:9
wkhlhwtkvot להשתחות to worship 1 Samuel 1:3
pkhpkot פחות viceroys Jeremiah 51:23
zrkmzrkh מזרחה toward the sunrise Jeremiah 31:40
xmkxmkh צמחה the growth Psalms 65:11

lz (211)
zbklzbokלזבח to sacrifice 1 Kings 3:4
ylzaylozhאעלזה I will exult Psalms 60:8
zryulzryçולזרעך and to your seed Numbers 18:19
zatlzat לזאת this one Genesis 2:23
zhhlzh הלזה this Genesis 24:65
zrylzryç לזרעך to your seed Genesis 24:7
znhlznunimלזנונים from harlotry Genesis 38:24

ln (86) including one side of the phrase ploni almoni, an old idiom? used only three times - not always politely.

clnhclnh כלנה Kalneh Amos 6:2
zblnzbulunזבלון Zebulun Psalms 68:28
plniploniפלני what a Ruth 4:1
kln-kilon חלן Helon Numbers 1:9
wlnihwlni השלני the Shelanites Numbers 26:20
gvln-golnגולן Golan Deuteronomy 4:43
gilnihgiloniהגילני the Gilonite 2 Samuel 15:12
plniploniפלני suitable 1 Samuel 21:3
plniploniפלני suitable 2 Kings 6:8

ls (23) for roots, (92) if we include the use of l as a prefix.

blsubolsובולס a tender of Amos 7:14
plstplsunתפלסון you level out Psalms 58:3
qlsvqls וקלס and ridicule Psalms 44:14
ylsnylsh נעלסה a peacock thrilled Job 39:13
alsralsr אלסר Eliasar Genesis 14:1

lx is also used for the grammatical role of l (179) and for letters of roots after the first (89 of the 179).

klxiiklxunיחלצון may be rescued Psalms 60:7
plxplxutפלצות tremors Psalms 55:6
ylxiylxuיעלצו they will be elated Psalms 68:4
klxaklxç אחלצך I will rescue you Psalms 50:15
klxvklxni וחלצני and rescue me Psalms 119:153
mlx-nmlxuנמלצו gratifying Psalms 119:103

sw (0), pm (65) including those times when m is a suffix. 10 roots end in pm - but only names.
+npa'tnpm אטנפם should I soil them Song 5:3
apapm אפם their anger Psalms 124:3
rdprodpmרדפם their persecutor Psalms 35:6
wpmvwpm ושפם and Shepham 1 Chronicles 5:12
wpvpmlwpupmלשפופם of Shpupham Numbers 26:39
wpvpmihwupmiהשופמי the Shpuphamites Numbers 26:39
kvpmlkupmלחופם of Xupam Numbers 26:39
kvpmihkupmiהחופמי the Xupamites Numbers 26:39

xw (0), qz (0), qk (1,050)

wlkviqkuויקחו and they sent for Genesis 37:31
pqkpiqkim פקחים the sighted Exodus 23:8
lqklqokלקוח take Ezekiel 24:5
rqkhmrqkh המרקחה its perfume Ezekiel 24:10

ts (1) root (84) with grammatical usage.

Wednesday, 2 February 2022

Individual letter pairs that don't begin any roots - tet

 Tet 't ט is the second least used letter in the first two letters of a root. Where did the extra t sound come from? And where has it gone? Was it primal or secondary? Four additional single empty slots in the 401 pages of the concordance involve tet - these are 'ts, 'tq, 'tw, and h't. v't has already been looked at. Tet occurs 6,266 times in the middle of words. But it never occurs in the sequence 'ts or 'tq. 

'tw, however, has 65 uses.

strtstirni תסתירני you will hide me Psalms 64:3
strtstir תסתיר is hidden Psalms 44:25
sprtspruתספרו you may recount it Psalms 48:14
smctsmcni תסמכני support me Psalms 51:14
svrvtsr ותסר and she put aside Genesis 38:14
ntsntsuנתסו they disfigure Job 30:13
n+wni'twh נטשה abandoned Amos 5:2
l+wmlu'twמלטש honed Psalms 52:4
r+wiru'twuירטשו were dashed to pieces Nahum 3:10
p+wp'twihonפטשיהון their tunics Daniel 3:21

And the sequence h't occurs 19 times.

rh+brh'tim ברהטים in the girders Song 7:6
lh+loh'timלהטים with those who are blazing Psalms 57:5
bh+bh't בהט marble Esther 1:6

Single pairs of letters with tet not used in the first two letters of a root. (See also this post.)

Individual letter pairs that don't begin any roots - vav

Looking first at vav. It occurs as the second letter of a root with every letter in the alphabet. So all its one-sided non-uses are in the first position of a root va-vd, vz-v't, vc-vm, vs, vy, vx-vr, vt - 16 of the 37 empty single slots in the table of the 401 concordance pages - see this post.

vav and its pattern of usage in the first two letters of a Hebrew root

 There are lots and lots of examples of v followed by other letters. They are pervasive. Vav is a connector of words used for and but so or if - then and many other variations.

But very few roots begin with vav. There is only one that is itself Hebrew, and that is the word vav itself. Just as vav (also written as waw) connects words together, so also it is the hook that connects all the pieces of the tabernacle together. 

All 28 of the words beginning with vav in the Hebrew Bible can be scanned in the smallest volume of pages in the concordance beginning here

vwtivwti ושתי Vashti Esther 1:9
vvvvi ווי the hooks of Exodus 27:10
vhb-vhb והב Vehav Numbers 21:14
vpsi-vopsiופסי Vopsi Numbers 13:14
vwnivwni ושני Vashni 1 Chronicles 6:13
vnihvnih וניה Vanyah Ezra 10:36

Note the importance of vav in this visual Midrash as outlined in this post by David Z. Moster, "Scribing the Tabernacle: A Visual Midrash Embedded in the Torah Scroll" TheTorah.com (2016). https://thetorah.com/article/scribing-the-tabernacle-a-visual-midrash-embedded-in-the-torah-scroll




Tuesday, 1 February 2022

Unused letter pairs in Hebrew?

Continuing with 'rare' double letters. I look at 20 pairs in this post. In subsequent posts I will look at the 37 singles and 10 double letters (which will turn out to not be rare, but only rare as the first two letters of a root. This principle is known as gemination.) 

So the 20 pairs - are they rare?  Yes and no. It's a lot of information. The lists are a somewhat random selection from the available examples.

g't - t'g score 0 hits. 't (tet) is a curious letter, a second t sound. Perhaps the fact that it does not occur adjacent to g is a hint for both of them as to their pronunciation.

gc (0) but cg is frequent where the prefix is 'c' - similar to bp but only where the prefix is 'b'.

For gx there are zero results but for xg, the root ixg exists - used 16 times across 10 books.

ixg vhxigu והציגו and exhibit Amos 5:15
ixg vhxigni והצגני he has exhibited me Job 17:6
ixg vixg ויצג and he exhibited Genesis 30:38

gq (0)

dz (0) but zd (32). Here there is an instance of a vav in a root disappearing in the word and resulting in these two consonants adjacent to each other. I have noted before the tendency of z to become d in Aramaic words. E.g. דכרניא the archives, an aspect of memory zcr in Hebrew. There seems to be some metastasis with d in Dan 2:9.
zvd vizd ויזד and stewed Genesis 25:29
zvd zdim זדים the presumptuous Psalms 119:122
azd azda אזדא has vanished Daniel 2:5
zmn hzdmntun הזדמנתון you cooked up together Daniel 2:9
adr adrzda אדרזדא with excellence Ezra 7:23

d't (0) but 'td  (10)
p+d p'tdt פטדת the topaz of Job 28:19
a+d ha'td האטד the brierpatch Genesis 50:10

hy (2,634) but zero occurrence in any root. I.e. like earlier examples, it is only the h as playing its grammatical roles.

and yh (1,814)
wmy hwmuyh השמועה the report Jeremiah 51:46
ryh riyç רעך your associate Deuteronomy 5:21
ryy ryh רעה evil Jeremiah 51:2
wby nwbyh נשבעה we will be satisfied Psalms 65:5
qrqy hqrqyh הקרקעה towards Qarqaa Joshua 15:3

z't (0), zs (0), zx (0)

ky (2) yk(0) - as suspected and will occur when we get to rarely used words, some are borrowed or are names or both.
irky irky ירחע Yarxa 1 Chronicles 2:34
irky lirky לירחע to Yarxa 1 Chronicles 2:35

'tc (0), 'tx (0)

'tt (1), t't (0)
q+t vq'tt וקטת and Qattat Joshua 19:15

cx (87) all related to the use of c as a prefix. xc (23) all arx with the pronoun suffix cm

cq (41) all related to the use of c as a prefix. qc (1) koqcm your decreed (bricks) Ex 5:14

lr (0) no uses of l with a root beginning with r! rl (138)
yrl yorltm ערלתם their foreskins Genesis 17:23
grl vgorl וגורל and the lot of Leviticus 16:8
yrl -yorlotihm ערלתיהם their foreskins 1 Samuel 18:27
grl lgorlç לגרלך in your lot Daniel 12:13

sx (0)

xt (210) 't' being a grammatical letter and a means of elision, it appears in various guises in these examples.
rvx bmruxtm במרוצתם to their own racing Jeremiah 8:6
iyx yxt עצת the counsel of Jeremiah 49:20
amx aimxtiç אמצתיך I will assure you Isaiah 41:10
qxh umqxt ומקצת and a limited number of Nehemiah 7:69
ixa vhxti והצתי and I will bring forth Jeremiah 50:32
npx vnipxti ונפצתי and I will smash Jeremiah 51:23
ixt iixtu יצתו they will be charred Jeremiah 51:58

tx(207)

xma txmau תצמאו will be thirsty Isaiah 65:13
xvm txumu תצומו you fast Isaiah 58:4
ntx vttxu ותתצו and you have broken down Isaiah 22:10
xmk txmknh תצמחנה they grow Isaiah 42:9
nxl vtxilm ותצילם and you delivered Nehemiah 9:28
ixa -txa תצא you do go forth Jeremiah 38:18
xhl vtxhlu ותצהלו and neigh Jeremiah 50:11

The matrix of letter pairs for the Hebrew concordance

 When I first looked at a Hebrew lexicon, I wanted to see the frequency of use of the letters. One question was - how would I design a concordance by volume? If it was by single letter, some volumes would be too big and some too small. It turned out that letter pairs would work as an organizational scheme, and by the size of the pages, one could tell something about the language. 

There are 401 'pages' in my concordance. That means that there are several missing. 22 x 22 would mean I should have 484 pages (+5 for the single prefixes).  So 88 pages are missing. 

Look at this picture again. Can you see 88 empty slots? Subtract each right column count from 22 and add them up and it comes to 88. Each empty slot has or doesn't have a paired empty slot which is the reverse of the two missing letters. The image with the empty slots highlighted is below.

..abagadahavazaka+aiacalamanasayapaxaqarawat21
bbabbbgbdbhbvbzbkb+bibcblbmbnbsbybxbqbrbwbt21
gagbgggdghgvgzgkgiglgmgngygpgrgwgt17
dadbdgdddhdvdkdidcdldmdndydpdqdrdwdt18
hhahbhghd..hvhkhihchlhmhnhshphxhqhrhwht18
vhvvvivnvpvw 6
zazbzgzhzvzzzkzizczlzmznzyzpzqzrzt17
kbkgkdkvkz
..
k+kikcklkmknkskpkxkqkrkwkt18
+a+b+h+v+k+++i+l+m+n+y+p+r13
iaibigidihiviziki+iiiciliminisiyipixiqiriwit22
ccacbcdchcvczck
ci
..
clcmcncscycpcrcwct17
llalblgldlhlvlkl+lilc
..
lmlylplqlwlt16
mmambmgmdmhmvmzmkm+mimcmlmmmnmsmympmxmqmrmwmt22
nanbngndnhnvnznkn+nincnlnm
..
nsnynpnxnqnrnwnt21
sasbsgsdshsvsks+siscslsmsnsssyspsqsrst19
yaybygydyvyzy+yiycylymynys
..
ypyxyqyrywyt19
papgpdphpvpzpkp+pipcplpnpspy
..
pxpqprpwpt19
xaxbxdxhxvxkxixlxmxnxyxp
..
xqxr14
qaqbqdqhqvq+qiqlqmqnqsqyqpqx
..
qrqwqt17
rarbrgrdrhrvrzrkr+rircrmrnrsryrprxrq
..
rwrt20
wawbwgwdwhwvwzwkw+wiwcwlwmwnwswywpwxwqwrwwwt22
tatbtgtdthtvtztktitctltmtntytptqtrtwtt19
19201719192214181422161920201418201217191819

If there is a ^ in an empty slot, then its corresponding reverse pair is not empty, i.e. there are roots beginning with these two letters. If there is a # in the slot then both pairs are empty, i.e. there are no words beginning with these two letters. 

Of the 88 empty slots 40 have # in them, 20 on each side of the diagonal containing the double letters. If you joined them with a line, the lines would all be parallel to each other - some shorter, some longer.
And 37 empty slots have ^ in them showing that their corresponding pair has a page for that letter pair. The remaining 11 slots are the empty double letters (half the alphabet).

..abagadahavazaka+aiacalamanasayapaxaqarawat21
bbabbbgbdbhbvbzbkb+bibcblbmbnbsby#bxbqbrbwbt21
gagbgggdghgvgzgk#gi#glgmgn^gygp##grgwgt17
dadbdgdddhdv#dk#didcdldmdn^dydp^dqdrdwdt18
hhahbhghd..hv^hk^hihchlhmhnhs#hphxhqhrhwht18
^^^^vhvv^^^vi^^^vn^^vp^^^vw^ 6
zazbzg#zhzvzzzk#zizczlzmzn#zyzp#zqzr^zt17
^kbkgkd^kvkz
..
k+kikcklkmknks#kpkxkqkrkwkt18
+a+b##+h+v#+k+++i#+l+m+n^+y+p#^+r^#13
iaibigidihiviziki+iiiciliminisiyipixiqiriwit22
ccacb#cdchcvczck#ci
..
clcmcncscycp##crcwct17
llalblgldlhlv^lkl+lilc
..
lm^^lylp^lq#lwlt16
mmambmgmdmhmvmzmkm+mimcmlmmmnmsmympmxmqmrmwmt22
nanbngndnhnvnznkn+nincnlnm
..
nsnynpnxnqnrnwnt21
sasbsgsdshsv#sks+siscslsmsnsssysp#sqsr^st19
yaybygyd#yvyz#y+yiycylymynys
..
ypyxyqyrywyt19
pa#pgpdphpvpzpkp+pipcpl^pnpspy
..
pxpqprpwpt19
xaxb#xdxhxv#xk#xi#xlxmxn#xyxp
..
xqxr^#14
qaqb#qdqhqv^^q+qi#qlqmqnqsqyqpqx
..
qrqwqt17
rarbrgrdrhrvrzrkr+rirc#rmrnrsryrprxrq
..
rwrt20
wawbwgwdwhwvwzwkw+wiwcwlwmwnwswywpwxwqwrwwwt22
tatbtgtdthtvtztk#titctltmtn^tytp#tqtrtwtt19
19201719192214181422161920201418201217191819
Next post we will see if these pairs, like bp pb, ever show up anywhere in a Hebrew word.